Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Ultrasensitive Visible Blue Nucleic Acid Gel Stain

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Exendin (5-39) - ANA63898 - 1 mg - AnaSpec - proteins & peptides

Exendin (5-39)
print page
Size: 1 mg
£345.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63898
Name:
Exendin (5-39)
Supplier:
Availability:

This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (5-39) antagonizes GLP-1–stimulated insulin release after food intake.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3806.3
Reference:
Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997)Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993)
UNSPSC Code:
12352202
Contact Our Customer Service Team
Tonbo Biosciences