Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
High Purity Frozen Cord Blood Buffy Coat

Highly effective & efficient in vitro delivery of Cas9 RNP for genome editing in challenging cells

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) - ANA62565 - 1 mg - AnaSpec - proteins & peptides

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
print page
Size: 1 mg
£689.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62565
Name:
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Supplier:
Availability:

This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Storage Temp:
-20°C
Molecular Weight:
4843.5
Reference:
Kumar, P. et al. Nature 448, 39 (2007).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team