PrEST Antigen STAT2
Catalogue number:
APrEST77482
Supplier:
Size:
100 µl _$$_
Product is available in:
PrEST Antigen STAT2, Gene description: signal transducer and activator of transcription 2, 113kDa, Alternative Gene Names: STAT113, Antigen sequence: DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
- Data sheet: View or download
- MSDS: View or download
Storage Temperature:
Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.