www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen HMOX1

Catalogue number:
APrEST73438
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen HMOX1, Gene description: heme oxygenase (decycling) 1, Alternative Gene Names: bK286B10, HO-1, Antigen sequence: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-HMOX1 HPA000635 · Atlas Antibodies
HPA000635
Atlas Antibodies
100 µl £351.00
100 µl
view
Anti-HMOX1 AMAb91719 · Atlas Antibodies
AMAb91719
Atlas Antibodies
100 µl £299.00
100 µl
view
Anti-HMOX1 AMAb91721 · Atlas Antibodies
AMAb91721
Atlas Antibodies
100 µl £299.00
100 µl
view