Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
High Purity Frozen Cord Blood Buffy Coat

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Elafin - ANA61641 - 0.1 mg - AnaSpec - proteins & peptides

Elafin
print page
Size: 0.1 mg
£313.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61641
Name:
Elafin
Supplier:
Availability:

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular_weight cationic peptide with the ability to eliminate pulmonary pathogens.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5999.3
Reference:
King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).
UNSPSC Code:
12352202
Contact Our Customer Service Team
Tonbo Biosciences