www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen AGPAT5

Catalogue number:
APrEST71502
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen AGPAT5, Gene description: 1-acylglycerol-3-phosphate O-acyltransferase 5, Alternative Gene Names: FLJ11210, LPAAT-e, LPAAT-epsilon, Antigen sequence: ANHQSTVDWIVADILAIRQNALGHVRYVLKEGLKWLPLYGCYFAQHGGIYVKRSAKFNEKEMRNKLQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-AGPAT5 HPA010950 · Atlas Antibodies
HPA010950
Atlas Antibodies
100 µl £438.00
100 µl
view
Anti-AGPAT5 HPA011646 · Atlas Antibodies
HPA011646
Atlas Antibodies
100 µl £438.00
100 µl
view