www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen KCNH5

Catalogue number:
APrEST70663
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen KCNH5, Gene description: potassium voltage-gated channel, subfamily H (eag-related), member 5, Alternative Gene Names: eag2, H-EAG2, Kv10.2, Antigen sequence: GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-KCNH5 HPA030487 · Atlas Antibodies
HPA030487
Atlas Antibodies
100 µl £438.00
100 µl
view