www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen VSX2

Catalogue number:
APrEST70659
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen VSX2, Gene description: visual system homeobox 2, Alternative Gene Names: CHX10, HOX10, RET1, Antigen sequence: LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-VSX2 HPA003436 · Atlas Antibodies
HPA003436
Atlas Antibodies
100 µl £413.00
100 µl
view