www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen ZBTB45

Catalogue number:
APrEST95315
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen ZBTB45, Gene description: zinc finger and BTB domain containing 45, Alternative Gene Names: FLJ14486, ZNF499, Antigen sequence: APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-ZBTB45 HPA075485 · Atlas Antibodies
HPA075485
Atlas Antibodies
100 µl £438.00
100 µl
view