www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen BRF1

Catalogue number:
APrEST95278
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen BRF1, Gene description: BRF1, RNA polymerase III transcription initiation factor subunit, Alternative Gene Names: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90, Antigen sequence: ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-BRF1 HPA074990 · Atlas Antibodies
HPA074990
Atlas Antibodies
100 µl £438.00
100 µl
view