www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen ADRA2B

Catalogue number:
APrEST95273
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen ADRA2B, Gene description: adrenoceptor alpha 2B, Alternative Gene Names: ADRA2L1, ADRA2RL1, ADRARL1, Antigen sequence: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-ADRA2B HPA074948 · Atlas Antibodies
HPA074948
Atlas Antibodies
100 µl £438.00
100 µl
view