www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen EXOG

Catalogue number:
APrEST95067
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen EXOG, Gene description: exo/endonuclease G, Alternative Gene Names: ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b, Antigen sequence: AALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-EXOG HPA071050 · Atlas Antibodies
HPA071050
Atlas Antibodies
100 µl £438.00
100 µl
view