www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen MATK

Catalogue number:
APrEST94933
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen MATK, Gene description: megakaryocyte-associated tyrosine kinase, Alternative Gene Names: CHK, CTK, DKFZp434N1212, HHYLTK, HYL, HYLTK, Lsk, MGC1708, MGC2101, Antigen sequence: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-MATK HPA066547 · Atlas Antibodies
HPA066547
Atlas Antibodies
100 µl £438.00
100 µl
view