www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen PNPLA6

Catalogue number:
APrEST94897
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen PNPLA6, Gene description: patatin like phospholipase domain containing 6, Alternative Gene Names: iPLA2delta, NTE, SPG39, sws, Antigen sequence: SYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-PNPLA6 HPA064773 · Atlas Antibodies
HPA064773
Atlas Antibodies
100 µl £438.00
100 µl
view