www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen SCN5A

Catalogue number:
APrEST94861
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen SCN5A, Gene description: sodium voltage-gated channel alpha subunit 5, Alternative Gene Names: CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1, Antigen sequence: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-SCN5A HPA063346 · Atlas Antibodies
HPA063346
Atlas Antibodies
100 µl £413.00
100 µl
view