www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen TNFSF13B

Catalogue number:
APrEST94611
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen TNFSF13B, Gene description: TNF superfamily member 13b, Alternative Gene Names: BAFF, BLYS, CD257, TALL-1, TALL1, THANK, TNFSF20, Antigen sequence: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-TNFSF13B HPA030526 · Atlas Antibodies
HPA030526
Atlas Antibodies
100 µl £413.00
100 µl
view