www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen CTNNBL1

Catalogue number:
APrEST94594
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen CTNNBL1, Gene description: catenin beta like 1, Alternative Gene Names: C20orf33, FLJ21108, NAP, NYD-SP19, P14, P14L, Antigen sequence: DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-CTNNBL1 HPA027906 · Atlas Antibodies
HPA027906
Atlas Antibodies
100 µl £438.00
100 µl
view