www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen PPP2R3B

Catalogue number:
APrEST94578
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen PPP2R3B, Gene description: protein phosphatase 2 regulatory subunit B''beta, Alternative Gene Names: PPP2R3L, PPP2R3LY, PR48, PR70, Antigen sequence: KTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-PPP2R3B HPA026606 · Atlas Antibodies
HPA026606
Atlas Antibodies
100 µl £438.00
100 µl
view