www.bioscience.co.uk
Sales & Support: +44 (0)1223 316 855

*

PrEST Antigen MAD2L2

Catalogue number:
APrEST94575
Size:
100 µl _$$_
Product is available in:
  • UK
  • Ireland
  • Europe
  • USA
  • Rest of World
£239.00 Shipping is calculated in checkout

PrEST Antigen MAD2L2, Gene description: mitotic arrest deficient 2 like 2, Alternative Gene Names: FANCV, MAD2B, POLZ2, REV7, Antigen sequence: TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details Cat number & supplier Size Price
Anti-MAD2L2 HPA024612 · Atlas Antibodies
HPA024612
Atlas Antibodies
100 µl £438.00
100 µl
view