Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Sensitive cGMP Quantification EIA Kit

Cecropin B - ANA24011 - 0.5 mg - AnaSpec - proteins & peptides

Cecropin B
print page
Size: 0.5 mg
£227.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24011
Name:
Cecropin B
Supplier:
Availability:

Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Storage Temp:
-20°C
Molecular Weight:
3834.7
Reference:
Vaara, M. et al. Antimicrob. Agents Chemo. 38, 2498 (1994); Florack, D. et al. Transgenic Res. 4, 132 (1995); Lee, P. et al. Wound Repair Regen. 12, 351 (2004).
UNSPSC Code:
12352202