Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Sensitive cGMP Quantification EIA Kit
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

BNP-32, Human - ANA24016 - 1 mg - AnaSpec - proteins & peptides

BNP-32, Human
print page
Size: 1 mg
£494.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24016
Name:
BNP-32, Human
Supplier:
Availability:

This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Storage Temp:
-20°C
Molecular Weight:
3464.1
Reference:
Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Sudoh, T. et al. Nature 332, 78 (1988); Cheung, B. et al. JAMA 280, 1983 (1998); Struthers, A. BMJ 308, 1615 (1994); De Lemos, JA. et al. Lancet 362, 316 (2005); Kambayashi, Y. et al. Biochem. Biophys. Res. Commun. 159, 1427 (1989).
UNSPSC Code:
12352202