Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Electrocompetent Cells With The Highest Transformation Efficiency

Cecropin A - ANA24010 - 1 mg - AnaSpec - proteins & peptides

Cecropin A
print page
Size: 1 mg
£373.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24010
Name:
Cecropin A
Supplier:
Availability:

Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Storage Temp:
-20°C
Molecular Weight:
4003.8
UNSPSC Code:
12352202