Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
High Quality DNA & RNA Purification From Agarose

Cecropin A - ANA24009 - 0.5 mg - AnaSpec - proteins & peptides

Cecropin A
print page
Size: 0.5 mg
£227.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24009
Name:
Cecropin A
Supplier:
Availability:

Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Storage Temp:
-20°C
Molecular Weight:
4003.8
Reference:
Silvestro, L. et al. Biophysical J. 72, A195 (1997); Andreu, D. et al. Proc. Natl. Acad. Sci. USA 80, 6475 (1983); Silvestro, L. et al. Biochem. 36, 11452 (1997).
UNSPSC Code:
12352202