Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Ion Channel Screening & Profiling Services
Over 40,000 Peptides & Proteins Available

Exendin 4 - ANA24463 - 0.5 mg - AnaSpec - proteins & peptides

Exendin 4
print page
Size: 0.5 mg
£122.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24463
Name:
Exendin 4
Supplier:
Availability:

Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage Temp:
-20°C
Molecular Weight:
4186.6
Reference:
Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993)
UNSPSC Code:
12352202