Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Express Lentiviral Packaging Services
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Peptide YY, Human - ANA24402 - 1 mg - AnaSpec - proteins & peptides

Peptide YY, Human
print page
Size: 1 mg
£325.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24402
Name:
Peptide YY, Human
Supplier:
Availability:

PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Storage Temp:
-20°C
Molecular Weight:
4309.8
Reference:
Tatemoto, K. et al. BBRC 157, 713 (1988); Halldén, G. and G. Aponte, J. Biol. Chem. 272, 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003).
UNSPSC Code:
12352202