Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Highly Characterised Polyclonal Antibodies

Exendin (9-39) - ANA24467 - 0.5 mg - AnaSpec - proteins & peptides

Exendin (9-39)
print page
Size: 0.5 mg
£298.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24467
Name:
Exendin (9-39)
Supplier:
Availability:

This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage Temp:
-20°C
Molecular Weight:
3369.8
Reference:
Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997)Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993)
UNSPSC Code:
12352202