Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
GLP Compliant Safety Pharmacology Services

Beta-Amyloid (1-40)-Lys(Biotin-LC), Human - ANA23518-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40)-Lys(Biotin-LC), Human
print page
Size: 0.1 mg
£227.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23518-01
Name:
Beta-Amyloid (1-40)-Lys(Biotin-LC), Human
Supplier:
Availability:

This C-terminal biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin-LC)
Storage Temp:
-20°C
Molecular Weight:
4797.5
UNSPSC Code:
12352202