Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Highly Characterised Polyclonal Antibodies
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Cys-beta-Amyloid (1-40), Human - ANA23520 - 1 mg - AnaSpec - proteins & peptides

Cys-beta-Amyloid (1-40), Human
print page
Size: 1 mg
£386.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23520
Name:
Cys-beta-Amyloid (1-40), Human
Supplier:
Availability:

Cys-beta-Amyloid (1-40)

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Molecular Weight:
4433
Reference:
Favit, A. et al. J. Neurochem. 75, 1258 (2000).
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents