Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
High Quality DNA & RNA Purification From Agarose

Glucagon-Like Peptide 1, GLP-1 (7-37) - ANA20762 - 1 mg - AnaSpec - proteins & peptides

Glucagon-Like Peptide 1, GLP-1 (7-37)
print page
Size: 1 mg
£355.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20762
Name:
Glucagon-Like Peptide 1, GLP-1 (7-37)
Supplier:
Availability:

GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
3355.7
Reference:
Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002)Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001)Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004)Rothstein, JD. et al. Neuron 16, 675 (1996)
UNSPSC Code:
12352202