PrEST Antigen LZIC

Catalogue number:

Add to favourites

APrEST91934

Supplier:

Atlas Antibodies

Size:

100 µl _$$_

Product is available in:

Currency:
GBP
EUR

£239.00

Shipping is calculated in checkout

This product is no longer available to order.

PrEST Antigen LZIC, Gene description: leucine zipper and CTNNBIP1 domain containing, Alternative Gene Names: MGC15436, Antigen sequence: KTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Data sheet: View or download
MSDS: View or download

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details	Cat number & supplier	Size	Price
PrEST Antigen GRASP APrEST92214 · Atlas Antibodies	APrEST92214 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen CPSF4 APrEST92642 · Atlas Antibodies	APrEST92642 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen BDH1 APrEST91943 · Atlas Antibodies	APrEST91943 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen KCNF1 APrEST93957 · Atlas Antibodies	APrEST93957 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen CYGB APrEST92168 · Atlas Antibodies	APrEST92168 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen AXDND1 APrEST88706 · Atlas Antibodies	APrEST88706 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen CMPK1 APrEST86154 · Atlas Antibodies	APrEST86154 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen C1orf52 APrEST92186 · Atlas Antibodies	APrEST92186 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen RPL29 APrEST88856 · Atlas Antibodies	APrEST88856 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen PEA15 APrEST93985 · Atlas Antibodies	APrEST93985 Atlas Antibodies	100 µl	£239.00 100 µl view

View product citations on CiteAb