PrEST Antigen PHRF1

Catalogue number:

Add to favourites

APrEST88006

Supplier:

Atlas Antibodies

Size:

100 µl _$$_

Product is available in:

Currency:
GBP
EUR

£239.00

Shipping is calculated in checkout

This product is no longer available to order.

PrEST Antigen PHRF1, Gene description: PHD and ring finger domains 1, Alternative Gene Names: KIAA1542, RNF221, Antigen sequence: ASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQAFSELPF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Data sheet: View or download
MSDS: View or download

Storage Temperature:

Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Details	Cat number & supplier	Size	Price
PrEST Antigen COL11A1 APrEST91900 · Atlas Antibodies	APrEST91900 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen MTFR1 APrEST89767 · Atlas Antibodies	APrEST89767 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen SDCCAG8 APrEST93083 · Atlas Antibodies	APrEST93083 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen PDK3 APrEST90379 · Atlas Antibodies	APrEST90379 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen MCOLN3 APrEST87954 · Atlas Antibodies	APrEST87954 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen DIP2B APrEST87742 · Atlas Antibodies	APrEST87742 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen MPC1 APrEST91683 · Atlas Antibodies	APrEST91683 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen PFKP APrEST89777 · Atlas Antibodies	APrEST89777 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen TAB2 APrEST92988 · Atlas Antibodies	APrEST92988 Atlas Antibodies	100 µl	£239.00 100 µl view
PrEST Antigen ATP2C2 APrEST93296 · Atlas Antibodies	APrEST93296 Atlas Antibodies	100 µl	£239.00 100 µl view

View product citations on CiteAb