Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Ethically Sourced & Fully Traceable Human Biospecimens for Cancer Research
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Upgrading Your Laser Scanner? Consider The Sapphire™

[Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human - ANA63672-05 - 0.5 mg - AnaSpec - proteins & peptides

[Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human
print page
Size: 0.5 mg
£345.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63672-05
Name:
[Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human
Supplier:
Availability:

Beta-Amyloid (1-42) and Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4530.2
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lena Biosciences