Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Small GTPase Activation Assays, Western blot

Transfection Ready Plasmid DNA In 20 Minutes With ZymoPURE II

Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat - ANA63356 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat
print page
Size: 0.1 mg
£235.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63356
Name:
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat
Supplier:
Availability:

Beta-Amyloid Peptides - Mouse/Rat

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4587.3
UNSPSC Code:
12352202
Contact Our Friendly Technical Team