Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Streamlined & Simplified DNA Bisulphite Conversion Kits
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

Beta-Amyloid (1-55), Human - ANA63335 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-55), Human
print page
Size: 0.1 mg
£329.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63335
Name:
Beta-Amyloid (1-55), Human
Supplier:
Availability:

Beta-Amyloid (1-43) to (1-49) and (1-55) Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5982.1
UNSPSC Code:
12352202
Contact Our Customer Service Team