Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
3D Cell Culture ECM Scaffolds - TissueSpec®
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Transfection Ready Plasmid DNA In 20 Minutes With ZymoPURE II

Beta-Amyloid (11-42), HiLyte™ Fluor 488-labeled, Human - ANA63327 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (11-42), HiLyte™ Fluor 488-labeled, Human
print page
Size: 0.1 mg
£258.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63327
Name:
Beta-Amyloid (11-42), HiLyte™ Fluor 488-labeled, Human
Supplier:
Availability:

This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3692.3
Reference:
Huse, J. T. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
UNSPSC Code:
12352202
Contact Our Customer Service Team