Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Quick Total RNA Purification Kits

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

Big Endothelin-1 (1-38), human - ANA62946-05 - 0.5 mg - AnaSpec - proteins & peptides

Big Endothelin-1 (1-38), human
print page
Size: 0.5 mg
£517.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62946-05
Name:
Big Endothelin-1 (1-38), human
Supplier:
Availability:

Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-convertingEnzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4283
Reference:
Fecteau; M. et al. Hypertension 46, 87 (2005).
UNSPSC Code:
12352202
Contact Our Customer Service Team