Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Transfection-Ready Plasmid DNA in <20 Minutes - ZymopPURE II Midi & Maxiprep Kits
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

Beta-Amyloid (1-40)-Cys, Human - ANA62233 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40)-Cys, Human
print page
Size: 0.1 mg
£164.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62233
Name:
Beta-Amyloid (1-40)-Cys, Human
Supplier:
Availability:

This synthetic peptide corresponds to β--Amyloid (1-40) with an additional cysteine at the C-terminus.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4433
UNSPSC Code:
12352202
Contact Our Customer Service Team