Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:

Exosome Specific Antibody Array - Exo-Check™

Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Upgrading Your Laser Scanner? Consider The Sapphire™

LL-37, reverse sequence - ANA62208 - 0.5 mg - AnaSpec - proteins & peptides

LL-37, reverse sequence
print page
Size: 0.5 mg
£204.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62208
Name:
LL-37, reverse sequence
Supplier:
Availability:

The reverse sequence of LL-37 (see Cat# 61302).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4493.3
UNSPSC Code:
12352202
Contact Our Friendly Technical Team