Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Specific STING Proteins
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

[Met(O)35]-beta-Amyloid (1-42), Human - ANA62478 - 0.5 mg - AnaSpec - proteins & peptides

[Met(O)35]-beta-Amyloid (1-42), Human
print page
Size: 0.5 mg
£414.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62478
Name:
[Met(O)35]-beta-Amyloid (1-42), Human
Supplier:
Availability:

Beta-Amyloid (1-42) and Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4530.1
UNSPSC Code:
12352202
Contact Our Customer Service Team