Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Custom sRNA Library Prep Sequencing Services

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

[Lys22]-beta-Amyloid (1-42), Italian Mutation, Human - ANA62148 - 0.5 mg - AnaSpec - proteins & peptides

[Lys22]-beta-Amyloid (1-42), Italian Mutation, Human
print page
Size: 0.5 mg
£376.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62148
Name:
[Lys22]-beta-Amyloid (1-42), Italian Mutation, Human
Supplier:
Availability:

This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4513.2
Reference:
Masuda, Y. et al. Bioorg. Med. Chem. 13, 6803 (2005).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team