Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Specific STING Proteins
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

[Lys22]-beta-Amyloid (1-40), Italian Mutation, Human - ANA62147 - 0.5 mg - AnaSpec - proteins & peptides

[Lys22]-beta-Amyloid (1-40), Italian Mutation, Human
print page
Size: 0.5 mg
£290.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62147
Name:
[Lys22]-beta-Amyloid (1-40), Italian Mutation, Human
Supplier:
Availability:

This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4328.9
Reference:
Masuda, Y. et al. Bioorg. Med. Chem. 13, 6803 (2005).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team