Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Exo-spin - Exceptional Yield Exosome Purification Kit
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

[Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human - ANA62145 - 0.5 mg - AnaSpec - proteins & peptides

[Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human
print page
Size: 0.5 mg
£290.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA62145
Name:
[Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human
Supplier:
Availability:

This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4328.9
Reference:
Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001); Grabowski, T. et al. Ann. Neurol. 49, 697 (2001).
UNSPSC Code:
12352202
Contact Our Customer Service Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents