Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Highly Characterised Polyclonal Antibodies
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

[Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, Human - ANA61967-05 - 0.5 mg - AnaSpec - proteins & peptides

[Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, Human
print page
Size: 0.5 mg
£475.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61967-05
Name:
[Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, Human
Supplier:
Availability:

This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4442.1
Reference:
Yamamoto, N. et al. J. Biol. Chem. 282, 2646 (2007), Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Tonbo Biosciences