Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
GPCR & Ion Channel Stable Cell Libes
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid (1-42)-Lys(Biotin)-NH2, Human - ANA61484-05 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-42)-Lys(Biotin)-NH2, Human
print page
Size: 0.5 mg
£797.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61484-05
Name:
Beta-Amyloid (1-42)-Lys(Biotin)-NH2, Human
Supplier:
Availability:

The difference between this recently released and the previous product (Cat# 23527) is the change at the C terminus from a carboxylic acid to an amide. The biological activity should remain the same.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4867.6
Reference:
Elbaum, D. et al. Biochem. Biophys. Res. Commun. 267, 733 (2000).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team