Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Highly Characterised Polyclonal Antibodies
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human - ANA61483-05 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human
print page
Size: 0.5 mg
£718.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61483-05
Name:
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human
Supplier:
Availability:

The difference between this recently released and the previous product (Cat# 23515) is the change at the C terminus from a carboxylic acid to an amide. The biological activity should remain the same.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4683.4
UNSPSC Code:
12352202
Contact Our Customer Service Team