Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Viromer® CRISPR
Find Your Peptide Simply with Our Peptide Search

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

CAP-18, rabbit - ANA61307 - 0.5 mg - AnaSpec - proteins & peptides

CAP-18, rabbit
print page
Size: 0.5 mg
£305.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61307
Name:
CAP-18, rabbit
Supplier:
Availability:

This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4433.5
Reference:
Travis, S et al. Infect. Immun. 68, 2748 (2000).
UNSPSC Code:
12352202
Contact Our Customer Service Team