Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Vector Shuttling & Clone Modification Service

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

GIP (1-42), human - ANA61226-05 - 0.5 mg - AnaSpec - proteins & peptides

GIP (1-42), human
print page
Size: 0.5 mg
£205.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61226-05
Name:
GIP (1-42), human
Supplier:
Availability:

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4983.6
Reference:
Brown, JC & JR Dryburgh Can J Biochem 49, 867 (1971), doi: 10.1139/o71-122 Buchan, MT. et al. Histochem 56, 37Dupre, J. et al. J Clin Endocrinol Metab 37, 826 (1973), doi: http://dx.doi.org/10.1210/jcem-37-5-826 Getty-Kaushik, L. et al. Obesity 14, 1124, doi: 10.1038/oby.2006.129
UNSPSC Code:
12352202
Contact Our Customer Service Team