Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Quantibody® Cancer Biomarker Arrays

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide - ANA61153 - 0.5 mg - AnaSpec - proteins & peptides

BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide
print page
Size: 0.5 mg
£400.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61153
Name:
BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide
Supplier:
Availability:

BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. Further, sequence identity between rat and mouse BNP prohormones is found to be more conserved in the N-terminal portion of the prohormone than in the C-terminal BNP-45 (88% versus 64%). The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence. Comparing the amino acid sequence surrounding the proteolytic processing site for BNP-32 in human, pig, and dog BNP with the corresponding site for BNP-45 in the rat and mouse sequence we find that all of the secreted BNP hormones have an N-terminal serine preceded by an arginine in the prohormone sequence, and the mouse and rat sequences are highly conserved at the putative scissile bond (LKRVLR-SQ). Further comparative sequence analysis indicates that an arginine being present at position -4 relative to the scissile (R-S) bond in all mammalian BNP precursors. Thus, processing of BNP prohormones to both BNP-45 in rodents and BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S). Also, the conserved sequences in the BNP prohormones matches the consensus cleavage site for human furin, a calcium-dependent serine endoprotease expressed in mouse heart, and possibly having a role in processing BNP precursors.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5040.8
Reference:
Steinhelper, ME. Circ. Res. 72: 984-992. (1993).
UNSPSC Code:
12352202
Contact Our Customer Service Team