Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Express Lentiviral Packaging Services

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Apelin-36, human - ANA61095 - 1 mg - AnaSpec - proteins & peptides

Apelin-36, human
print page
Size: 1 mg
£421.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61095
Name:
Apelin-36, human
Supplier:
Availability:

This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4195.9
Reference:
Ref: Cayabyab, M. et al. J. Virol. 74, 11972 (2000); Reaux-Le Goazigo, A. et al. Endocrinol. 145, 4392 (2004).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team