Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Powerful RNA Extraction From FFPE Samples

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid (3-40), Human - ANA61029 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (3-40), Human
print page
Size: 0.1 mg
£123.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA61029
Name:
Beta-Amyloid (3-40), Human
Supplier:
Availability:

Beta-Amyloid (1-40) and Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4143.7
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents